PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0033s0132.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 292aa    MW: 32525.7 Da    PI: 7.2907
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0033s0132.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.4e-32214272159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vk+s +prsYYrCt+ gC+vkk+ver +ed ++v++tYeg+H h+
  Kaladp0033s0132.1.p 214 LDDGYKWRKYGQKVVKNSLHPRSYYRCTQMGCRVKKRVERLSEDCRMVITTYEGRHSHP 272
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.1E-34199274IPR003657WRKY domain
SuperFamilySSF1182904.84E-29206274IPR003657WRKY domain
PROSITE profilePS5081131.514209274IPR003657WRKY domain
SMARTSM007742.5E-37214273IPR003657WRKY domain
PfamPF031069.2E-25215272IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGGGGGREF VFGSRDDDHQ GSIFSTHPRQ MELHHNNDDF LAASSSSAPA AANNRHVFTL  60
LSHHPNSSST STPATACVAA AGGSTMAMGF INCHNEEEEK DDDQHLFAAH DNRLLNAWKT  120
VYHQQHGLRS TILDPREADG VGNNEEDYHG DDTQTTKNSH SWWRRCPASS SSEKITSKAA  180
SGKISGSSTG VVKMRRKLRE PRFCFQTRTD IDVLDDGYKW RKYGQKVVKN SLHPRSYYRC  240
TQMGCRVKKR VERLSEDCRM VITTYEGRHS HPPPPPDDAN SSDHDPCFSS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25205274877Probable WRKY transcription factor 4
2lex_A2e-25205274877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473761.12e-58PREDICTED: probable WRKY transcription factor 12 isoform X1
SwissprotQ93WY43e-58WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A151QW854e-59A0A151QW85_CAJCA; Putative WRKY transcription factor 12
STRINGfgenesh2_kg.4__2664__AT2G44745.13e-56(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.19e-50WRKY family protein